RegulonDB RegulonDB 11.1: Amino acid Sequence
RNA decapping hydrolase Amino Acid Sequence


Size: 257

Fasta

 

>RNA decapping hydrolase E. coli K12. Version NC_000913.3 GI:556503834
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQ
RRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCR
ERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESG
IKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTV
ARRLIEDTVAMCRAEYE
              
                            

Download fasta file
RegulonDB