RegulonDB RegulonDB 11.1: Amino acid Sequence
ATP-binding protein PhoH Amino Acid Sequence


Size: 354

Fasta

 

>ATP-binding protein PhoH E. coli K12. Version NC_000913.3 GI:556503834
MVTSCTGHVLDNQRATTRGVFSSGSHLVTLHFQPHPFFSCVTDAVNGARSRFSAFYPKAN
YGLQGSQPSDVRAHNRAANGACDEYKQLKVLSMGRQKAVIKARREAKRVLRRDSRSHKQR
EEESVTSLVQMGGVEAIGMARDSRDTSPILARNEAQLHYLKAIESKQLIFATGEAGCGKT
WISAAKAAEALIHKDVDRIIVTRPVLQADEDLGFLPGDIAEKFAPYFRPVYDVLVRRLGA
SFMQYCLRPEIGKVEIAPFAYMRGRTFENAVVILDEAQNVTAAQMKMFLTRLGENVTVIV
NGDITQCDLPRGVCSGLSDALERFEEDEMVGIVRFGKEDCVRSALCQRTLHAYS
              
                            

Download fasta file
RegulonDB