RegulonDB RegulonDB 10.9: Amino acid Sequence
cytochrome c menaquinol dehydrogenase TorC Amino Acid Sequence


Size: 390

Fasta

 

>cytochrome c menaquinol dehydrogenase TorC E. coli K12. Version NC_000913.3 GI:556503834
MRKLWNALRRPSARWSVLALVAIGIVIGIALIVLPHVGIKVTSTTEFCVSCHSMQPVYEE
YKQSVHFQNASGVRAECHDCHIPPDIPGMVKRKLEASNDIYQTFIAHSIDTPEKFEAKRA
ELAEREWARMKENNSATCRSCHNYDAMDHAKQHPEAARQMKVAAKDNQSCIDCHKGIAHQ
LPDMSSGFRKQFDELRASANDSGDTLYSIDIKPIYAAKGDKEASGSLLPASEVKVLKRDG
DWLQIEITGWTESAGRQRVLTQFPGKRIFVASIRGDVQQQVKTLEKTTVADTNTEWSKLQ
ATAWMKKGDMVNDIKPIWAYADSLYNGTCNQCHGAPEIAHFDANGWIGTLNGMIGFTSLD
KREERTLLKYLQMNASDTAGKAHGDKKEEK
              
                            

Download fasta file
RegulonDB