RegulonDB RegulonDB 10.10: Amino acid Sequence
ribonuclease E inhibitor protein A Amino Acid Sequence


Size: 161

Fasta

 

>ribonuclease E inhibitor protein A E. coli K12. Version NC_000913.3 GI:556503834
MKYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRV
LVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAA
GEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
              
                            

Download fasta file
RegulonDB