RegulonDB RegulonDB 10.9: Amino acid Sequence
osmoregulated periplasmic glucans (OPGs) biosynthesis protein H Amino Acid Sequence


Size: 847

Fasta

 

>osmoregulated periplasmic glucans (OPGs) biosynthesis protein H E. coli K12. Version NC_000913.3 GI:556503834
MNKTTEYIDAMPIAASEKAALPKTDIRAVHQALDAEHRTWAREDDSPQGSVKARLEQAWP
DSLADGQLIKDDEGRDQLKAMPEAKRSSMFPDPWRTNPVGRFWDRLRGRDVTPRYLARLT
KEEQESEQKWRTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDLWV
SFMQLLPYMLQTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNP
EHRTALIMPICNEDVNRVFAGLRATWESVKATGNAKHFDVYILSDSYNPDICVAEQKAWM
ELIAEVGGEGQIFYRRRRRRVKRKSGNIDDFCRRWGSQYSYMVVLDADSVMTGDCLCGLV
RLMEANPNAGIIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAI
IRVKPFIEHCALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNL
LDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVV
HALTEPQYFLQPRQLFPVWPQWRPELAIALFASTMVLLFLPKLLSILLIWCKGTKEYGGF
WRVTLSLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTSWGEAFKRHG
SQLLLGLVWAVGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRATVGLRTKRWKLFLIPE
EYSPPQVLVDTDRFLEMNRQRSLDDGFMHAVFNPSFNALATAMATARHRASKVLEIARDR
HVEQALNETPEKLNRDRRLVLLSDPVTMARLHFRVWNSPERYSSWVSYYEGIKLNPLALR
KPDAASQ
              
                            

Download fasta file
RegulonDB