RegulonDB RegulonDB 10.8: Amino acid Sequence
RNA polymerase sigma E factor Amino Acid Sequence


Size: 191

Fasta

 

>RNA polymerase sigma E factor E. coli K12. Version NC_000913.3 GI:556503834
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRA
LDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEISNPEN
LMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREA
IDNKVQPLIRR
              
                            

Download fasta file
RegulonDB