RegulonDB RegulonDB 10.8: Amino acid Sequence
Rac prophage; recombinase RecT Amino Acid Sequence


Size: 269

Fasta

 

>Rac prophage; recombinase RecT E. coli K12. Version NC_000913.3 GI:556503834
MTKQPPIAKADLQKTQGNRAPAAVKNSDVISFINQPSMKEQLAAALPRHMTAERMIRIAT
TEIRKVPALGNCDTMSFVSAIVQCSQLGLEPGSALGHAYLLPFGNKNEKSGKKNVQLIIG
YRGMIDLARRSGQIASLSARVVREGDEFSFEFGLDEKLIHRPGENEDAPVTHVYAVARLK
DGGTQFEVMTRKQIELVRSLSKAGNNGPWVTHWEEMAKKTAIRRLFKYLPVSIEIQRAVS
MDEKEPLTIDPADSSVLTGEYSVIDNSEE
              
                            

Download fasta file
RegulonDB