RegulonDB RegulonDB 11.1: Amino acid Sequence
Sel1 repeat-containing protein YjcO Amino Acid Sequence


Size: 229

Fasta

 

>Sel1 repeat-containing protein YjcO E. coli K12. Version NC_000913.3 GI:556503834
MKKIIALMLFLTFFAHANDSEPGSQYLKAAEAGDRRAQYFLADSWFSSGDLSKAEYWAQK
AADSGDADACALLAQIKITNPVSLDYPQAKVLAEKAAQAGSKEGEVTLAHILVNTQAGKP
DYPKAISLLENASEDLENDSAVDAQMLLGLIYANGVGIKADDDKATWYFKRSSAISRTGY
SEYWAGMMFLNGEEGFIEKNKQKALHWLNLSCMEGFDTGCEEFEKLTNG
              
                            

Download fasta file
RegulonDB