RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF2574 domain-containing protein YehE Amino Acid Sequence


Size: 93

Fasta

 

>DUF2574 domain-containing protein YehE E. coli K12. Version NC_000913.3 GI:556503834
MNKYWLSGIIFLAYGLASPAFSSETATLAINGRISPPTCSMAMVNGQPQQHCGQLTYNVD
TRHLFSSPVKGVTTEVVVAGSDSKRRIVLNRYD
              
                            

Download fasta file
RegulonDB