RegulonDB RegulonDB 10.8: Amino acid Sequence
SWIM zinc finger domains-containing protein YehQ Amino Acid Sequence


Size: 614

Fasta

 

>SWIM zinc finger domains-containing protein YehQ E. coli K12. Version NC_000913.3 GI:556503834
MNSLRPELLELTPQALTALSNAGFVKRSLKELENGNVPEISHENDALIATFSDGVRTQLA
NGQALKEAQCSCGANGMCRHRVMLVLSYQRLCATTQSTEKEEEWDPAIWLEELATLPDAT
RKRAQALVAKGITIELFCAPGEIPSARLPMSDVRFYSRSSIRFARCDCIEGTLCEHVVLA
VQAFVEAKAQQAEFNHLIWQMRSEHVTSSDDPFASEEGNACRQYVQQLSQTLWLGGISQP
LIHYEAAFNRALQAAETCNWRWVSESLRQLRASVDAFHARASHYNAGECLHQLAALNSRL
NCAQEMARRDSIGEVPPVPWRTVVGSGIAGEAKLDHLRLVSLGMRCWQDIEHYGLRIWFT
DPDTGSILHLSRSWPRSEQENSPAATRRLFSFQAGALAGGQIVSQAAKRSADGELLLATR
NRLSSVVPLSPDAWQMLSAPLRQPGIVALREYLRQRPPACIRPLNQVDNLFILPVAECIS
LGWDSSRQTLDAQVISGEGEDNVLTLSLPASASAPYAVERMAALLQQTDDPVCLVSGFVS
FVEGQLTLEPRVMMTKTRAWALDAETTPVAPLPSASVLPVPSTAHQLLIRCQALLIQLLH
NGWRYQEQSAIGQA
              
                            

Download fasta file
RegulonDB