RegulonDB RegulonDB 10.8: Amino acid Sequence
putative oligopeptide ABC transporter ATP binding subunit YejF Amino Acid Sequence


Size: 529

Fasta

 

>putative oligopeptide ABC transporter ATP binding subunit E. coli K12. Version NC_000913.3 GI:556503834
MTQTLLAIENLSVGFRHQQTVRTVVNDVSLQIEAGETLALVGESGSGKSVTALSILRLLP
SPPVEYLSGDIRFHGESLLHASDQTLRGVRGNKIAMIFQEPMVSLNPLHTLEKQLYEVLS
LHRGMRREAARGEILNCLDRVGIRQAAKRLTDYPHQLSGGERQRVMIAMALLTRPELLIA
DEPTTALDVSVQAQILQLLRELQGELNMGMLFITHNLSIVRKLAHRVAVMQNGRCVEQNY
AATLFASPTHPYTQKLLNSEPSGDPVPLPEPASTLLDVEQLQVAFPIRKGILKRIVDHNV
VVKNISFTLRAGETLGLVGESGSGKSTTGLALLRLINSQGSIIFDGQPLQNLNRRQLLPI
RHRIQVVFQDPNSSLNPRLNVLQIIEEGLRVHQPTLSAAQREQQVIAVMHEVGLDPETRH
RYPAEFSGGQRQRIAIARALILKPSLIILDEPTSSLDKTVQAQILTLLKSLQQKHQLAYL
FISHDLHVVRALCHQVIILRQGEVVEQGPCARVFATPQQEYTRQLLALS
              
                            

Download fasta file
RegulonDB