RegulonDB RegulonDB 10.10: Amino acid Sequence
thiol:disulfide oxidoreductase CcmG Amino Acid Sequence


Size: 185

Fasta

 

>holocytochrome c synthetase - thiol:disulfide oxidoreductase CcmG E. coli K12. Version NC_000913.3 GI:556503834
MKRKVLLIPLIIFLAIAAALLWQLARNAEGDDPTNLESALIGKPVPKFRLESLDNPGQFY
QADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELG
NPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYS
KEAAQ
              
                            

Download fasta file
RegulonDB