RegulonDB RegulonDB 11.0: Amino acid Sequence
cytochrome c maturation protein C Amino Acid Sequence


Size: 245

Fasta

 

>heme trafficking system membrane protein CcmC E. coli K12. Version NC_000913.3 GI:556503834
MWKTLHQLAIPPRLYQICGWFIPWLAIASVVVLTVGWIWGFGFAPADYQQGNSYRIIYLH
VPAAIWSMGIYASMAVAAFIGLVWQMKMANLAVAAMAPIGAVFTFIALVTGSAWGKPMWG
TWWVWDARLTSELVLLFLYVGVIALWHAFDDRRLAGRAAGILVLIGVVNLPIIHYSVEWW
NTLHQGSTRMQQSIDPAMRSPLRWSIFGFLLLSATLTLMRMRNLILLMEKRRPWVSELIL
KRGRK
              
                            

Download fasta file
RegulonDB