RegulonDB RegulonDB 10.9: Amino acid Sequence
Ni(2+) ABC transporter membrane subunit NikB Amino Acid Sequence


Size: 314

Fasta

 

>Ni(2+) ABC transporter membrane subunit NikB E. coli K12. Version NC_000913.3 GI:556503834
MLRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGL
DQPLYVQYGTWLWKALHLDFGISFASQRPVLDDMLNFLPATLELAGAALVLILLTSVPLG
IWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGGWQHIILPA
VSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGM
HIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNA
ALDPRIRRHEGAHA
              
                            

Download fasta file
RegulonDB