RegulonDB RegulonDB 10.9: Amino acid Sequence
Ni(2+) ABC transporter ATP binding subunit NikE Amino Acid Sequence


Size: 268

Fasta

 

>Ni(2+) ABC transporter ATP binding subunit NikE E. coli K12. Version NC_000913.3 GI:556503834
MTLLNISGLSHHYAHGGFNGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVG
LESPAQGNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLL
SLKKSEQLARASEMLKAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVS
NLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQVVGEKL
TFSSDAGRVLQNAVLPAFPVRRRTTEKV
              
                            

Download fasta file
RegulonDB