RegulonDB RegulonDB 10.9: Amino acid Sequence
endoribonuclease toxin ChpB Amino Acid Sequence


Size: 116

Fasta

 

>endoribonuclease toxin ChpB E. coli K12. Version NC_000913.3 GI:556503834
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARY
AGFSVPLHCEEGDVHGVVLVNQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
              
                            

Download fasta file
RegulonDB