RegulonDB RegulonDB 10.9: Amino acid Sequence
CP4-57 prophage; DNA-binding transcriptional activator AlpA Amino Acid Sequence


Size: 70

Fasta

 

>CP4-57 prophage; DNA-binding transcriptional activator AlpA E. coli K12. Version NC_000913.3 GI:556503834
MNNRSAVRILRLPAVIQKTGMARATIYDWLNPKSPRYDATFPKKRMLGVKSVGWIEAEID
EWLSQRCKLI
              
                            

Download fasta file
RegulonDB