RegulonDB RegulonDB 10.9: Amino acid Sequence
trehalose-specific PTS enzyme IIBC component Amino Acid Sequence


Size: 473

Fasta

 

>trehalose-specific PTS enzyme IIBC component E. coli K12. Version NC_000913.3 GI:556503834
MMSKINQTDIDRLIELVGGRGNIATVSHCITRLRFVLNQPANARPKEIEQLPMVKGCFTN
AGQFQVVIGTNVGDYYQALIASTGQAQVDKEQVKKAARHNMKWHEQLISHFAVIFFPLLP
ALISGGLILGFRNVIGDLPMSNGQTLAQMYPSLQTIYDFLWLIGEAIFFYLPVGICWSAV
KKMGGTPILGIVLGVTLVSPQLMNAYLLGQQLPEVWDFGMFSIAKVGYQAQVIPALLAGL
ALGVIETRLKRIVPDYLYLVVVPVCSLILAVFLAHALIGPFGRMIGDGVAFAVRHLMTGS
FAPIGAALFGFLYAPLVITGVHQTTLAIDLQMIQSMGGTPVWPLIALSNIAQGSAVIGII
ISSRKHNEREISVPAAISAWLGVTEPAMYGINLKYRFPMLCAMIGSGLAGLLCGLNGVMA
NGIGVGGLPGILSIQPSYWQVFALAMAIAIIIPIVLTSFIYQRKYRLGTLDIV
              
                            

Download fasta file
RegulonDB