RegulonDB RegulonDB 10.9: Amino acid Sequence
iron-sulfur cluster insertion protein IscA Amino Acid Sequence


Size: 107

Fasta

 

>iron-sulfur cluster insertion protein IscA E. coli K12. Version NC_000913.3 GI:556503834
MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGV
KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
              
                            

Download fasta file
RegulonDB