RegulonDB RegulonDB 11.0: Amino acid Sequence
NapA signal peptide-binding chaperone NapD Amino Acid Sequence


Size: 87

Fasta

 

>NapA signal peptide-binding chaperone NapD E. coli K12. Version NC_000913.3 GI:556503834
MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTI
ESVRNVEGVLAVSLVYHQQEEQGEETP
              
                            

Download fasta file
RegulonDB