RegulonDB RegulonDB 10.8: Amino acid Sequence
branched chain amino acid transporter BrnQ Amino Acid Sequence


Size: 439

Fasta

 

>branched chain amino acid transporter BrnQ E. coli K12. Version NC_000913.3 GI:556503834
MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAAFGFLITAVGLPVLTV
VALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTATVSFEVGIAPLTGDSAL
PLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILSVAAIVWPAGSISTATEA
YQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEARLLTRYTVWAGLMAGVGLT
LLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSFLLAALIFIACLVTAVGLTC
ACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQISVPVLTAIYPPCIALVVLSFT
RSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSWAQRLPLAEQGLAWLMPTVVMV
VLAIIWDRAAGRQVTSSAH
              
                            

Download fasta file
RegulonDB