RegulonDB RegulonDB 10.8: Amino acid Sequence
muropeptide:H+ symporter Amino Acid Sequence


Size: 491

Fasta

 

>muropeptide:H+ symporter E. coli K12. Version NC_000913.3 GI:556503834
MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENIDLKTIGFFSLVGQAYV
FKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPGTQLRWMAALAVVIAFC
SASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLALWLADKWLGWQGMYWLM
AALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRNNAWLILLLIVLYKLGDAF
AMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGILMQRLSLFRALLIFGILQG
ASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVALLMTLCNKSFSATQFALLSAL
SAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILLLVCRQTLEYTRVNDNFISRTA
YPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSFLPALLEVGVLVALSGVVLGGLL
DYLALRKTHLT
              
                            

Download fasta file
RegulonDB