RegulonDB RegulonDB 10.8: Amino acid Sequence
nitrogen regulator GlnK Amino Acid Sequence


Size: 112

Fasta

 

>nitrogen regulator GlnK E. coli K12. Version NC_000913.3 GI:556503834
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVK
IDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
              
                            

Download fasta file
RegulonDB