RegulonDB RegulonDB 10.9: Amino acid Sequence
chaperone modulator CbpM Amino Acid Sequence


Size: 101

Fasta

 

>chaperone modulator CbpM E. coli K12. Version NC_000913.3 GI:556503834
MANVTVTFTITEFCLHTGISEEELNEIVGLGVVEPREIQETTWVFDDHAAIVVQRAVRLR
HELALDWPGIAVALTLMDDIAHLKQENRLLRQRLSRFVAHP
              
                            

Download fasta file
RegulonDB