RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF2002 domain-containing protein YgaC Amino Acid Sequence


Size: 114

Fasta

 

>protein YgaC E. coli K12. Version NC_000913.3 GI:556503834
MYLRPDEVARVLEKVGFTVDVVTQKAYGYRRGENYVYVNREARMGRTALVIHPTLKERSS
TLAEPASDIKTCDHYQQFPLYLAGERHEHYGIPHGFSSRVALERYLNGLFGEAS
              
                            

Download fasta file
RegulonDB