RegulonDB RegulonDB 10.10: Amino acid Sequence
universal stress protein B Amino Acid Sequence


Size: 111

Fasta

 

>putative universal stress (ethanol tolerance) protein B E. coli K12. Version NC_000913.3 GI:556503834
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV
RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
              
                            

Download fasta file
RegulonDB