RegulonDB RegulonDB 10.10: Amino acid Sequence
multidrug efflux pump membrane fusion protein MdtE Amino Acid Sequence


Size: 385

Fasta

 

>multidrug efflux pump membrane fusion protein MdtE E. coli K12. Version NC_000913.3 GI:556503834
MNRRRKLLIPLLFCGAMLTACDDKSAENAAAMTPEVGVVTLSPGSVNVLSELPGRTVPYE
VAEIRPQVGGIIIKRNFIEGDKVNQGDSLYQIDPAPLQAELNSAKGSLAKALSTASNARI
TFNRQASLLKTNYVSRQDYDTARTQLNEAEANVTVAKAAVEQATINLQYANVTSPITGVS
GKSSVTVGALVTANQADSLVTVQRLDPIYVDLTQSVQDFLRMKEEVASGQIKQVQGSTPV
QLNLENGKRYSQTGTLKFSDPTVDETTGSVTLRAIFPNPNGDLLPGMYVTALVDEGSRQN
VLLVPQEGVTHNAQGKATALILDKDDVVQLREIEASKAIGDQWVVTSGLQAGDRVIVSGL
QRIRPGIKARAISSSQENASTESKQ
              
                            

Download fasta file
RegulonDB