RegulonDB RegulonDB 10.9: Amino acid Sequence
outer membrane protein YiaT Amino Acid Sequence


Size: 246

Fasta

 

>outer membrane protein YiaT E. coli K12. Version NC_000913.3 GI:556503834
MLINRNIVALFALPFMASATASELSIGAGAAYNESPYRGYNENTKAIPLISYEGDTFYVR
QTTLGFILSQSEKNELSLTASWMPLEFDPTDNDDYAMQQLDKRDSTAMAGVAWYHHERWG
TVKASAAADVLDNSNGWVGELSVFHKMQIGRLSLTPALGVLYYDENFSDYYYGISESESR
RSGLASYSAQDAWVPYVSLTAKYPIGEHVVLMASAGYSELPEEITDSPMIDRNESFTFVT
GVSWRF
              
                            

Download fasta file
RegulonDB