RegulonDB RegulonDB 10.9: Amino acid Sequence
putative sulfurtransferase YibN Amino Acid Sequence


Size: 143

Fasta

 

>putative sulfurtransferase YibN E. coli K12. Version NC_000913.3 GI:556503834
MQEIMQFVGRHPILSIAWIALLVAVLVTTFKSLTSKVKVITRGEATRLINKEDAVVVDLR
QRDDFRKGHIAGSINLLPSEIKANNVGELEKHKDKPVIVVDGSGMQCQEPANALTKAGFA
QVFVLKEGVAGWAGENLPLVRGK
              
                            

Download fasta file
RegulonDB