RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF3300 domain-containing protein YacH Amino Acid Sequence


Size: 617

Fasta

 

>DUF3300 domain-containing protein YacH E. coli K12. Version NC_000913.3 GI:556503834
MKMTLPFKPHVLALICSAGLCAASTGLYIKSRTVEAPVEPQSTQLAVSDAAAVTFPATVS
APPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPTNVAQAVQWSHDNPLKQ
GDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDSVQRLRQ
LAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLTANPVITEPATTVISIEPA
NPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSFVRGFGYSMGVATTYALFSS
IDWDDDDHDHHHHDNDDYHHHDGGHRDGNGWQHNGDNINIDVNNFNRITGEHLTDKNMAW
RHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPTRDSQRQAAANQFQQRTHAAPV
ITRDTQRQAAAQRFNEAEHYGSYDDFHDFSRRQPLTQQQKDAARQRYQSASPEQRQAVRE
RMQTNPKIQQRREAARERIQSASPEQRQAVREKMQTNPQNQQRRDAARERIQSASPEQRQ
VFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFREKVQESRPQRLNDSNHTVRLNNEQR
SAVCERLSERGARRLER
              
                            

Download fasta file
RegulonDB