RegulonDB RegulonDB 10.9: Amino acid Sequence
putative solute:Na+ symporter Amino Acid Sequence


Size: 332

Fasta

 

>putative solute:Na+ symporter E. coli K12. Version NC_000913.3 GI:556503834
MKLFRILDPFTLTLITVVLLASFFPARGDFVPFFENLTTAAIALLFFMHGAKLSREAIIA
GGGHWRLHLWVMCSTFVLFPILGVLFAWWKPVNVDPMLYSGFLYLCILPATVQSAIAFTS
MAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNVHGAGGSLEQVGKIMLQLLLPFVLGHL
SRPWIGDWVSRNKKWIAKTDQTSILLVVYTAFSEAVVNGIWHKVGWGSLLFIVVVSCVLL
AIVIVVNVFMARRLSFNKADEITIVFCGSKKSLANGIPMANILFPTSVIGMMVLPLMIFH
QIQLMVCAVLARRYKRQTEQLQAQQESSADKA
              
                            

Download fasta file
RegulonDB