RegulonDB RegulonDB 10.8: Amino acid Sequence
RcsD phosphotransferase Amino Acid Sequence


Size: 890

Fasta

 

>RcsD phosphotransferase E. coli K12. Version NC_000913.3 GI:556503834
MRQKETTATTRFSLLPGSITRFFLLLIIVLLVTMGVMVQSAVNAWLKDKSYQIVDITHAI
QKRVDNWRYVTWQIYDNIAATTSPSSGEGLQETRLKQDVYYLEKPRRKTEALIFGSHDNS
TLEMTQRMSTYLDTLWGAENVPWSMYYLNGQDNSLVLISTLPLKDLTSGFKESTVSDIVD
SRRAEMLQQANALDERESFSNMRRLAWQNGHYFTLRTTFNQPGHLATVVAFDLPINDLIP
PGMPLDSFRLEPDATATGNNDNEKEGTDSVSIHFNSTKIEISSALNSTDMRLVWQVPYGT
LLLDTLQNILLPLLLNIGLLALALFGYTTFRHFSSRSTENVPSTAVNNELRILRAINEEI
VSLLPLGLLVHDQESNRTVISNKIADHLLPHLNLQNITTMAEQHQGIIQATINNELYEIR
MFRSQVAPRTQIFIIRDQDREVLVNKKLKQAQRLYEKNQQGRMIFMKNIGDALKEPAQSL
AESAAKLNAPESKQLANQADVLVRLVDEIQLANMLADDSWKSETVLFSVQDLIDEVVPSV
LPAIKRKGLQLLINNHLKAHDMRRGDRDALRRILLLLMQYAVTSTQLGKITLEVDQDESS
EDRLTFRILDTGEGVSIHEMDNLHFPFINQTQNDRYGKADPLAFWLSDQLARKLGGHLNI
KTRDGLGTRYSVHIKMLAADPEVEEEEERLLDDVCVMVDVTSAEIRNIVTRQLENWGATC
ITPDERLISQDYDIFLTDNPSNLTASGLLLSDDESGVREIGPGQLCVNFNMSNAMQEAVL
QLIEVQLAQEEVTESPLGGDENAQLHASGYYALFVDTVPDDVKRLYTEAATSDFAALAQT
AHRLKGVFAMLNLVPGKQLCETLEHLIREKDVPGIEKYISDIDSYVKSLL
              
                            

Download fasta file
RegulonDB