RegulonDB RegulonDB 11.1: Amino acid Sequence
PF10636 family protein YdiE Amino Acid Sequence


Size: 63

Fasta

 

>PF10636 family protein YdiE E. coli K12. Version NC_000913.3 GI:556503834
MRYTDSRKLTPETDANHKTASPQPIRRISSQTLLGPDGKLIIDHDGQEYLLRKTQAGKLL
LTK
              
                            

Download fasta file
RegulonDB