RegulonDB RegulonDB 10.8: Amino acid Sequence
DsrE/F sulfur relay family protein YchN Amino Acid Sequence


Size: 117

Fasta

 

>DsrE/F sulfur relay family protein YchN E. coli K12. Version NC_000913.3 GI:556503834
MQKIVIVANGAPYGSESLFNSLRLAIALREQESNLDLRLFLMSDAVTAGLRGQKPGEGYN
IQQMLEILTAQNVPVKLCKTCTDGRGISTLPLIDGVEIGTLVELAQWTLSADKVLTF
              
                            

Download fasta file
RegulonDB