RegulonDB RegulonDB 10.10: Amino acid Sequence
dipeptide ABC transporter ATP binding subunit DppF Amino Acid Sequence


Size: 334

Fasta

 

>dipeptide ABC transporter ATP binding subunit DppF E. coli K12. Version NC_000913.3 GI:556503834
MSTQEATLQQPLLQAIDLKKHYPVKKGMFAPERLVKALDGVSFNLERGKTLAVVGESGCG
KSTLGRLLTMIEMPTGGELYYQGQDLLKHDPQAQKLRRQKIQIVFQNPYGSLNPRKKVGQ
ILEEPLLINTSLSKEQRREKALSMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLDP
DVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFISHDLSVVEHIADEVMVMYLGRC
VEKGTKDQIFNNPRHPYTQALLSATPRLNPDDRRERIKLSGELPSPLNPPPGCAFNARCR
RRFGPCTQLQPQLKDYGGQLVACFAVDQDENPQR
              
                            

Download fasta file
RegulonDB