RegulonDB RegulonDB 10.8: Amino acid Sequence
putative NAD(P)H-dependent oxidoreductase YcaK Amino Acid Sequence


Size: 196

Fasta

 

>putative NAD(P)H-dependent oxidoreductase YcaK E. coli K12. Version NC_000913.3 GI:556503834
MQSERIYLVWAHPRHDSLTAHIADAIHQRAMERKIQVTELDLYRRNFNPVMTPEDEPDWK
NMDKRYSPEVHQLYSELLEHDTLVVVFPLWWYSFPAMLKGYIDRVWNNGLAYGDGHKLPF
NKVRWVALVGGDKESFVQMGWEKNISDYLKNMCSYLGIEDADVTFLCNTVVFDGEELHAS
YYQSLLSQVRDMVDAL
              
                            

Download fasta file
RegulonDB