RegulonDB RegulonDB 10.10: Amino acid Sequence
ribosome assembly factor YhbY Amino Acid Sequence


Size: 97

Fasta

 

>ribosome assembly factor YhbY E. coli K12. Version NC_000913.3 GI:556503834
MNLSTKQKQHLKGLAHPLKPVVLLGSNGLTEGVLAEIEQALEHHELIKVKIATEDRETKT
LIVEAIVRETGACNVQVIGKTLVLYRPTKERKISLPR
              
                            

Download fasta file
RegulonDB