RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF1418 domain-containing protein YbjC Amino Acid Sequence


Size: 95

Fasta

 

>DUF1418 domain-containing protein YbjC E. coli K12. Version NC_000913.3 GI:556503834
MRAIGKLPKGVLILEFIGMMLLAVALLSVSDSLSLPEPFSRPEVQILMIFLGVLLMLPAA
VVVILQVAKRLAPQLMNRPPQYSRSEREKDNDANH
              
                            

Download fasta file
RegulonDB