RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidoglycan DD-carboxypeptidase/peptidoglycan DD-endopeptidase Amino Acid Sequence


Size: 385

Fasta

 

>peptidoglycan DD-carboxypeptidase/peptidoglycan DD-endopeptidase E. coli K12. Version NC_000913.3 GI:556503834
MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQ
RVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGA
RVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQ
AAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMD
VPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPLTRF
KNMSDGINDLVTELSGNKPLVIPAS
              
                            

Download fasta file
RegulonDB