RegulonDB RegulonDB 10.10: Amino acid Sequence
ferrous iron transport protein FeoC Amino Acid Sequence


Size: 78

Fasta

 

>ferrous iron transport protein FeoC E. coli K12. Version NC_000913.3 GI:556503834
MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGS
CKSCPEGKACLREWWALR
              
                            

Download fasta file
RegulonDB