RegulonDB RegulonDB 10.8: Amino acid Sequence
putative transport protein YqcE Amino Acid Sequence


Size: 425

Fasta

 

>putative transport protein YqcE E. coli K12. Version NC_000913.3 GI:556503834
MQHNSYRRWITLAIISFSGGVSFDLAYLRYIYQIPMAKFMGFSNTEIGLIMSTFGIAAII
LYAPSGVIADKFSHRKMITSAMIITGLLGLLMATYPPLWVMLCIQIAFAITTILMLWSVS
IKAASLLGDHSEQGKIMGWMEGLRGVGVMSLAVFTMWVFSRFAPDDSTSLKTVIIIYSVV
YILLGILCWFFVSDNNNLRSANNEEKQSFQLSDILAVLRISTTWYCSMVIFGVFTIYAIL
SYSTNYLTEMYGMSLVAASYMGIVINKIFRALCGPLGGIITTYSKVKSPTRVIQILSVLG
LLTLTALLVTNSNPQSVAMGIGLILLLGFTCYASRGLYWACPGEARTPSYIMGTTVGICS
VIGFLPDVFVYPIIGHWQDTLPAAEAYRNMWLMGMAALGMVIVFTFLLFQKIRTADSAPA
MASSK
              
                            

Download fasta file
RegulonDB