RegulonDB RegulonDB 10.8: Amino acid Sequence
ribonucleoside-diphosphate reductase 2 subunit α Amino Acid Sequence


Size: 714

Fasta

 

>ribonucleoside-diphosphate reductase 2 subunit α E. coli K12. Version NC_000913.3 GI:556503834
MATTTAECLTQETMDYHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQ
QRLNWLVNEGYYDESVLNRYSRDFVITLFTHAHTSGFRFQTFLGAWKFYTSYTLKTFDGK
RYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFL
LRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLED
AFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLA
KENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFE
SGYPYIMYEDTVNRANPIAGRINMSNLCSEILQVNSASEYDENLDYTRTGHDISCNLGSL
NIAHTMDSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAR
EGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQG
NWQPKTAKVGELFTRSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATS
SIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALYQDAYEIGAEKIIDTYAEATRHVDQG
LSLTLFFPDTATTRDINKAQIYAWRKGIKTLYYIRLRQMALEGTEIEGCVSCAL
              
                            

Download fasta file
RegulonDB