RegulonDB RegulonDB 10.9: Amino acid Sequence
acyl carrier protein Amino Acid Sequence


Size: 78

Fasta

 

>acyl carrier protein E. coli K12. Version NC_000913.3 GI:556503834
MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA
EKITTVQAAIDYINGHQA
              
                            

Download fasta file
RegulonDB