RegulonDB RegulonDB 10.10: Amino acid Sequence
NAD(P)H-dependent nitroreductase NfsB Amino Acid Sequence


Size: 217

Fasta

 

>NAD(P)H nitroreductase NfsB E. coli K12. Version NC_000913.3 GI:556503834
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
              
                            

Download fasta file
RegulonDB