RegulonDB RegulonDB 11.0: Amino acid Sequence
flagellar export ATPase FliI Amino Acid Sequence


Size: 457

Fasta

 

>flagellum-specific ATP synthase FliI E. coli K12. Version NC_000913.3 GI:556503834
MTTRLTRWLTTLDNFEAKMAQLPAVRRYGRLTRATGLVLEATGLQLPLGATCVIERQNGS
ETHEVESEVVGFNGQRLFLMPLEEVEGVLPGARVYAKNISAEGLQSGKQLPLGPALLGRV
LDGSGKPLDGLPSPDTTETGALITPPFNPLQRTPIEHVLDTGVRPINALLTVGRGQRMGL
FAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGAEGRARSVVIAAPAD
VSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPS
VFAKLPALVERAGNGISGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEA
GHYPAIDIEASISRAMTALISEQHYARVRTFKQLLSSFQRNRDLVSVGAYAKGSDPMLDK
AIALWPQLEGYLQQGIFERADWEASLQGLERIFPTVS
              
                            

Download fasta file
RegulonDB