RegulonDB RegulonDB 10.8: Amino acid Sequence
L,D-transpeptidase domain-containing protein LdtF Amino Acid Sequence


Size: 246

Fasta

 

>L,D-transpeptidase domain-containing protein LdtF E. coli K12. Version NC_000913.3 GI:556503834
MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVK
MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAINIGFPNA
YDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALVFGQPSVQVSIYPFRMTD
ANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKPLSHEVVQPQLASNY
TLPEAK
              
                            

Download fasta file
RegulonDB