RegulonDB RegulonDB 11.1: Amino acid Sequence
CP4-6 prophage; RadC-like JAB domain-containing protein YkfG Amino Acid Sequence


Size: 158

Fasta

 

>CP4-6 prophage; RadC-like JAB domain-containing protein YkfG E. coli K12. Version NC_000913.3 GI:556503834
MKQLSFLPGEMTPQDRRLIQRALRALDRHLHEPGVAFTSTHAVREWLRLHMAALEREEFR
VLYLDNQNQLIAHETLFTGTINRTEVHPREVVKRALHFNAAAVILAHNHPSGETTPSQAD
KTLTQRLVQVLQLVDIRVPDHLIVGGRQIYSFAEHGLL
              
                            

Download fasta file
RegulonDB