RegulonDB RegulonDB 10.8: Amino acid Sequence
reactive chlorine species resistance protein C Amino Acid Sequence


Size: 197

Fasta

 

>reactive chlorine species resistance protein C E. coli K12. Version NC_000913.3 GI:556503834
MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITPFVANSPLMSFFYEHP
EDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLVLANPVNRWLGLLGGLM
AFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKDTLMLAGAVMIMADSARE
ILKQRSNESSSTLKTEY
              
                            

Download fasta file
RegulonDB