RegulonDB RegulonDB 11.0: Amino acid Sequence
putative acyltransferase, N-terminal fragment Amino Acid Sequence


Size: 675

Fasta

 

>putative acyltransferase, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MDLLPFLLDANLSATNPPAIPHWWKRQPLIPNLLSQELKNYLKLNVKEKNIQIADQVIID
ETAGEVVIGANTRICHGAVIQGPVVIGANCLIGNSNYAFIRPGTIISNGVKIGFATEIKN
AVIEAEATIGPQCFIADSVVANQAYLGAQVRTSNHRLDEQPVSVRTPEGIIATGCDKLGC
YIGQRSRLGVQVIILPGRIISPNTQLGPRVIVERNLPTGTYSLRQELIRTGD
              
                            

Download fasta file
RegulonDB