RegulonDB RegulonDB 10.8: Amino acid Sequence
putative transporter ProY Amino Acid Sequence


Size: 457

Fasta

 

>putative transporter ProY E. coli K12. Version NC_000913.3 GI:556503834
MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLAYIIGGIAAYIIMR
ALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPT
VPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIMIVAGFGIIIWGIGNGGQ
PTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVP
MRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITFAASILNFVVLTASLSAINS
DVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTTALLFAVYLNYIMPENVFLVI
ASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVPGGVATTIGGLIFLLFIIGLIG
YHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ
              
                            

Download fasta file
RegulonDB